PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG609200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 259aa    MW: 27411.9 Da    PI: 6.2351
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG609200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM38.34e-12336596128
                  NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +g + gl+ktL+fy+grap ge+tdWvmheyrl
  Pavir.9NG609200.1.p  33 DGGVYGLRKTLIFYRGRAPCGERTDWVMHEYRL 65 
                          67789**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100518.732188IPR003441NAC domain
SuperFamilySSF1019414.32E-163187IPR003441NAC domain
PfamPF023655.6E-53265IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MRGAVEGLDG SIRARRRSLR GSEGEISCLC DGDGGVYGLR KTLIFYRGRA PCGERTDWVM  60
HEYRLCQDLA HGACNFIGAY ALCRVIKRHE AGLLQGEPAA RAKGASNAAG GRAQMSKLSA  120
FRPTNSSPPP TLDMSREMCA MAESGSTFQS PLAYGGDATA TATTGLPSSP LPPPLFVPSG  180
HSSPPHDTFF IGGDDMGMVS AAEHELRWDS FAYPSTFSNG AEMWNAAASP MLCRQASDGG  240
VDDLAMMLQP NPSNEMVL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF7954888e-65JF795488.1 Zea mays NAC transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008658556.11e-58PREDICTED: NAC domain-containing protein 67-like
TrEMBLA0A096R9062e-58A0A096R906_MAIZE; Uncharacterized protein
STRINGGRMZM2G082709_P014e-58(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.17e-19NAC domain containing protein 71